DPCstruct | MC26240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438M4Z6 | 1-186 | MPRRCPIGQCRVCLGWGEKPQFADCIACSSWRQLHPAQARCRRCGHGSRVNTDGLCRLCLLTIRLDEPEWVAAPVGGRSAQLILILP… |
| A0A1M7PYN6 | 66-228 | PGSCVGCLAFGVYRGNSWLCWTCRWWRQHYPVGGCLYCDRTSAINGEGACRLCWENARRVQEIGRAVDLGQANRHGQQLYLANNQYD… |
| A0A4R5B534 | 1-172 | None |
| A0A1I5JNF6 | 5-170 | None |
| A0A5N8X9A0 | 177-342 | None |
| A0A2E0RWQ4 | 56-219 | None |
| G2P520 | 6-181 | None |
| A0A3N6E9H5 | 52-220 | None |
| A0A4P9SDD6 | 46-226 | None |
| A0A1H9W4A5 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.