DPCstruct | MC2624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 179 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1VN05 | 1-175 | MDKSLTVSKLDAAKRQLEVFIRLYFNSGDPVAMHTLVAAAFGVIRDLNKRRGGDPTLHESIFQNVKPEHHKLLRDKLTEAQNFFKHA… |
| A0A6J4FMC9 | 3-191 | TPKKMAISKMDAVKAQLETAIKLYFEDRDLISAYTLCAAADQILEDIWKHERDSILSRRIQRGQNVSHLMFSMCDEWKIRLEDEHRR… |
| A0A534UPS3 | 1-190 | None |
| A0A7X1VPT3 | 19-224 | None |
| A0A3S0C6L5 | 2-198 | None |
| A0A522BD57 | 1-168 | None |
| A0A7J5VNA2 | 2-150 | None |
| A0A532EQ61 | 8-177 | None |
| A0A7C3CXL7 | 1-179 | None |
| A0A2A6JYQ2 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.