DPCstruct | MC26238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1C7V7 | 11-124 | SPGMLPLFPMLSEDVRAMARHCTLGIEPRISSERIILLDTQPLFSPSVLAEIMRPDGSSTVSVISGESLSAELAHDLMSIQLGILLA… |
| A0A7J5XSX0 | 2-108 | SLLSANTPEEDQRGYVFRAQSQEIKERGGNQSTGIDFFITQERVIFLDTQPMLSPSILDHLINNDRKLPPEYNLPHTYVEMQIAAFL… |
| A0A438E2G1 | 1-116 | None |
| A9VCA1 | 21-169 | None |
| R1E1J4 | 61-167 | None |
| A0A4S8JJI6 | 112-237 | None |
| A0A6A4VPD4 | 114-233 | None |
| A0A7I4F5T9 | 18-182 | None |
| A0A7R9A3A9 | 140-249 | None |
| A0A6A5HAQ8 | 46-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.