DPCstruct | MC26236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5XI20 | 8-137 | ASVSDLPQPPVDFNGEVDMECQQKNPFAVPPTFHFWAPWIGKNTRRSNHVLNTEFAKVRRQKPAEVQEITVTEDRLREELYKQKVEV… |
| A0A6P6LYN3 | 101-221 | LSGNDIEKPPGNFKGEVNLEEFWESLSKEMISRGFVANGRHDLFAVPPSYHFWAPWIGKNTRHSDTVLNTEFEKVTEERLREELFKQ… |
| A0A498LG83 | 167-338 | None |
| A0A2G8LIJ4 | 440-588 | None |
| A0A498NZU8 | 1-158 | None |
| A0A6P8SWV0 | 322-470 | None |
| A0A498M8R1 | 1-144 | None |
| A0A6A5ERY4 | 13-158 | None |
| A0A437BYI8 | 120-266 | None |
| A0A0F8CYW1 | 80-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.