DPCstruct | MC26233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 115 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484BYM7 | 6-102 | HISVIQKNNTLRLTRCTVCCTKYHCPLCPTSLYKPRCRAKVLQHMEVHVKNAIQHEDFFITKCHQACRSGSSGHFHCPICLRTTIKR… |
| A0A7J5XAW1 | 1-123 | MHISIQEGRSLPDFQRCTTCCEDFHCPFCASNVFHPAKLSKVQTHLESHFNRAVLYEGYTIHRCALHCKPRFHFHCFYCQSMLTRKA… |
| C3ZHT3 | 8-195 | None |
| A0A6J8DVS0 | 16-109 | None |
| A0A7J5Y9F5 | 1-103 | None |
| N1PB64 | 219-314 | None |
| R7TCF2 | 4-123 | None |
| A0A3Q4M9U4 | 1-150 | None |
| R7U2B2 | 7-116 | None |
| A0A2B4SG76 | 217-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.