DPCstruct | MC26230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9D701 | 4-128 | TSTREVLVVALRNGILPQQVPVAEVLSSAELARFGLPTEAQVRLPDTVVYSTAHSALFFIDIGPIDSSRLAELKEWSNTALYPRVYV… |
| A0A533QDJ4 | 3-100 | LPIDTAESLPDVILFSGHEKRLVIIEAVISSGPVNPICLEQLQKFTKESSKLGYKISYVTAFPSRAVFRRFVEEIAWGSSVWIENEP… |
| A0A6L8FY67 | 494-618 | None |
| A0A1E3XBH1 | 81-223 | None |
| A0A1X0ECH9 | 234-357 | None |
| A0A7X7E1U2 | 26-156 | None |
| A0A2X2IE16 | 17-122 | None |
| A0A3D2G907 | 30-179 | None |
| R7R8L0 | 8-109 | None |
| A0A1E7YWE7 | 223-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.