DPCstruct | MC26226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 283 ± 52 aa |
| Standard deviation of domain lengths | 51.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8RYJ5 | 30-239 | TVLYAQEPTPRTTSVEIPPSRTINNATINNTNGVVIAGGDLTLNGTLTFTVGNVTTNANTVIIGGTGTVSRTSGHVIGNLKKIYPAA… |
| A0A5J5IL60 | 432-705 | GSTYFQQTFYGPDSCLGNLTVSAEGAASVNFAGNNLYIGKGLSLQNNGSGTIVHDNGSSAIYFIGADTANYSYSGSGAVPSLRNIGI… |
| A0A2N5YWT3 | 1-231 | None |
| A0A2N5YST1 | 18-326 | None |
| A0A537I391 | 21-530 | None |
| A0A7V3Y2D8 | 2-227 | None |
| A0A1M6A975 | 635-913 | None |
| A0A3C1R5T0 | 16-266 | None |
| A0A521IEB1 | 392-715 | None |
| A0A5E8AKF4 | 55-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.