DPCstruct | MC26223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 2 aa |
| Standard deviation of domain lengths | 2.23 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660UZK4 | 105-191 | SLQQFEMMLQEQSPDLPPKSIKLSFLAENEQLWIRPAGFGEKCTTDGEGSPVGMEIWQGRLRVIVFNDINSEDPQIIDLENARETAR |
| A0A1G2Y5K2 | 2-93 | SKNIYTILLKEQCADTLLPSEIKVKILSEGGQIWIQPDGFGGKCAMDGEGYPIGIEIWQGRLRLIIFDDINSEDPQIIDLENARETC… |
| A0A3A6Q517 | 66-153 | None |
| A0A2D6W225 | 16-104 | None |
| A0A7X7IHW7 | 252-338 | None |
| A0A5C7PUX6 | 1-85 | None |
| A0A1Z9X281 | 151-236 | None |
| A0A4Q6J744 | 226-316 | None |
| A0A290PVQ7 | 75-160 | None |
| A0A2D6MI44 | 42-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.