DPCstruct | MC2622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 22.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5LNE4 | 57-177 | MSSPNLTSSELIALCDTTRRSFSDNFIPFTNLQLEKVQKSSTLVRSNRHSIGKNAPKLRAHTVLSELWTHCPEGFILCALSTYQSRL… |
| A0A6A6ESB9 | 1-141 | MATKSSGWLIDQLKKKMEGFNTETYPLASSEIRAFKTYYELLKEDASSLKRRSKQRRSARLRVRSLLVDVFFGIGQEVFLLCTLAVS… |
| A0A6A7ALE6 | 1-144 | None |
| A0A2T5M139 | 4-121 | None |
| A0A5N7CV19 | 30-157 | None |
| Q2U1L8 | 1-181 | None |
| A0A093XZM4 | 292-415 | None |
| A0A1J9QXN7 | 3-164 | None |
| A0A229XZ97 | 11-125 | None |
| A0A365N1D7 | 3-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.