DPCstruct | MC26219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 215 ± 29 aa |
| Standard deviation of domain lengths | 29.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XVG3 | 1-266 | MLSLSTRSRRSTWNPTESLNSPSNRRKQNLTALDDDVDDITILSKYGKPGKPDDLAMVPVYLSGAQKELFFSPLRQVDPNEPDGKHV… |
| A0A0N5AF07 | 776-984 | QVPHVKDPGPSNVNTTPDVMKKTGAFLRRNYLSQRKEDSAIVTTQNSAGNAASFMDPSSIPVYMTEAENKAIFSFVVPDKTSPGKLY… |
| A0A183ULA3 | 724-891 | None |
| A0A0N4VHN5 | 1-221 | None |
| A0A3P7JIS5 | 120-297 | None |
| A0A183FQB7 | 76-292 | None |
| A0A183GF75 | 358-549 | None |
| A0A0R3PZK0 | 454-648 | None |
| A0A498SHT9 | 151-386 | None |
| A0A016SUF7 | 579-816 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.