DPCstruct | MC26213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2GET9 | 10-59 | GTVTALENGLARTPPMGWMSWTAFYCEIDCVKHPKGCINEILYMEMADEL |
| A0A0N4XQM3 | 4-62 | LSVLLLSCFTASALDNGLARTPPMGWMSWTAFYCQMDCVKFPKACINENLYMEMADALG |
| A0A7E4RS98 | 7-59 | None |
| A0A131YXJ5 | 7-62 | None |
| A0A5K3G1X0 | 23-86 | None |
| A0A7R9JFM7 | 45-95 | None |
| A0A7R9MQA5 | 4-63 | None |
| U4TY26 | 102-165 | None |
| A0A7R9CRT7 | 5-54 | None |
| T1GT71 | 9-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.