DPCstruct | MC26211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 19.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF21381- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384TJR2 | 219-381 | LQMQNYTIAFPALIKADLRFSLKTVNYKNAGPMTPSECYQFDVKIFFDNQNMDGQMLLSLDVFPIRLQCIGDIKYIDGNRLDYILRT… |
| A0A0N4XQ60 | 1-163 | MYLNLTNREVEEIRSDVHAVARVFERRGVSFKSEDALIISKATLNFKLRTIHFSPKSGDQKPECYKISVFITFDNSRHTGQVHVGLS… |
| A0A182JTW3 | 215-336 | None |
| A0A1J1IXI4 | 457-624 | None |
| A0A5N4DHR8 | 81-215 | None |
| A0A7R8WFH7 | 105-297 | None |
| A0A822GH47 | 2-140 | None |
| A0A060Z5R1 | 271-410 | None |
| A0A6A0GZX8 | 179-345 | None |
| A0A061I3P6 | 501-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.