DPCstruct | MC26209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 68.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8PGC4 | 678-753 | PLCCTLCRERLEDTHFVQCPSVPLHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGSSVPWAFMQGEIATILAGD |
| A0A7R9HZY1 | 379-464 | TGTVPSTTTLKCTLCQERLEDTHFVQCPSVPHHKFCFPCSRDSIKRQGAGSEVYCPSGEKCPLANSIVPWAFMQGEIATILGEEYK |
| A0A0V0U507 | 523-636 | None |
| A0A044U5Z7 | 321-428 | None |
| A0A016V449 | 241-345 | None |
| A0A0R3S0G3 | 3-114 | None |
| A0A6F9DFJ0 | 643-735 | None |
| A7RZW7 | 238-331 | None |
| A0A0R3RBF0 | 1-112 | None |
| A0A183M572 | 240-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.