DPCstruct | MC26207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 220 ± 21 aa |
| Standard deviation of domain lengths | 21.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 71.79 |
| Assigned Pfam label(s) | CL0020- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XIL7 | 1-231 | MPFGCDFIAKAVSVHVGGANVPAWLKSLRLHKYTAMFTELTYEEMMALDEIELERRNVTKGARTKILQSIQKLYSRASDLRAMHERL… |
| A0A2S2NXL5 | 81-278 | LEDSQSLIDLTILNQEMDGAVAKWLHYLKLHKYQWFFNSLSYLEIVFIDEDNIDDFIAKVNKNSITKGAQKKICISTKTLRDRPQKL… |
| A0A0D8XVD3 | 16-206 | None |
| A0A6L5DDQ2 | 204-402 | None |
| A0A3B3XFU5 | 211-456 | None |
| A0A482WVT2 | 289-488 | None |
| A0A7R9A4U3 | 503-728 | None |
| A0A653CUG7 | 228-445 | None |
| A0A0N4W7W9 | 18-236 | None |
| A0A3L8S977 | 30-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.