DPCstruct | MC26206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 236 |
|---|---|
| Mean domain length (aa) | 189 ± 32 aa |
| Standard deviation of domain lengths | 31.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 99.67 |
| Assigned Pfam label(s) | CL0063- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7LLQ9 | 26-196 | RPQIDRIDGGVATFIDGSSGEFDAIILCTGYLHHYPFLPEHLHLRSPNNLYPGGLYRGVTWQANPHLHYLGAQNQWFTFNMFDAQAW… |
| A0A0N4XIL1 | 11-193 | NILEFTEHGVIFENGSRVENVDTVIFATGYQFHFPMVECGQLIPVKENEVDLYEYMYPTETADHNSLAVVGLIQPVGSIMPISEMQA… |
| A0A366R6I3 | 285-476 | None |
| A0A2T6ZVK7 | 177-385 | None |
| A0A2T2UQ05 | 164-381 | None |
| A0A4Y4BWZ3 | 76-257 | None |
| A0A2N9I2S5 | 237-443 | None |
| A0A7R9A2D5 | 260-454 | None |
| A0A3N4JHP6 | 36-206 | None |
| A0A2G8LGV0 | 38-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.