DPCstruct | MC26205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 23.74 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3CV97 | 18-167 | SLPRHKLNSYHIKMEDEGNHGNDETRCFILSTLAAHNSPKVVCLLCQSTLPVYDRYPLVDGTFFLSPRQHSKHCFEAKVEGKTQYLS… |
| A0A0N4XIE9 | 34-142 | NDCPQGGDDVRLCLLKTLGAHNQRVVPCVGCHRDMIVYDRYPLVDGVFFLSPVCHFGPPTEVMYDGKRNYLQQLCATCLWSDWRCNN… |
| A0A7M7GJ60 | 439-588 | None |
| G0P8P1 | 49-190 | None |
| A0A834NMI1 | 79-198 | None |
| A0A835P484 | 276-423 | None |
| A0A5S6QDT2 | 20-150 | None |
| T1EGF4 | 1-180 | None |
| A0A4C1UM82 | 239-359 | None |
| A0A7R9LII0 | 173-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.