DPCstruct | MC26203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XIB7 | 13-121 | MLVNSSTHGSAFSLNDGQCVSMLMKMALDLDLTLSYHKRRGDIELCFESNRTAEKSGGRGKVLCLSDMGREIRVIERVNGTPTDTEM… |
| A0A182E700 | 8-96 | YQLADEQRITGMLQLAMEIDHKFTFIQRNNEFCFEPNDPTLKGRSIVLLDGGTVIIVIERFNGIELSREIWQKAYWNQFLWAVRGKC… |
| A0A183UWY2 | 455-580 | None |
| A0A044UA97 | 243-344 | None |
| A0A368G6K0 | 42-155 | None |
| A0A0R3QA43 | 141-249 | None |
| A0A090LE55 | 111-222 | None |
| A0A4U5ME91 | 327-490 | None |
| A0A4U5ME89 | 120-256 | None |
| A0A0K0E353 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.