DPCstruct | MC26200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 96.56 |
| Assigned Pfam label(s) | CL0179- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XH66 | 23-109 | VYKGVIYAGLMVTADGAQLLEYNCRFGDPETEVLMRLLKSDLYSVCTACVNGTLSELNIEWDDRHACGIILASRNYPYSGDKGTVID |
| B7A7U1 | 9-88 | VEEEILWPLVRGLEAEGVVYRGVIYAGLMLTREGPKVLEFNARFGDPEAQAVLPLLQSDLVELALKVAEGRLQGTRLSWR |
| A0A1V5R052 | 610-702 | None |
| A0A837Q346 | 63-141 | None |
| A0A7C2LGY5 | 60-157 | None |
| A0A845WE91 | 62-142 | None |
| A0A3B9JB06 | 233-324 | None |
| A0A482WZ60 | 1-96 | None |
| A0A839IX75 | 581-678 | None |
| T0E9A3 | 140-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.