DPCstruct | MC2620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 23.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2M4C9 | 5-162 | RTGGRLEKYCSHAYTHATKKGIKSLPAVLKGSDMVTYETFESLGMRVDIRPELEIDSSKWYYDSEDEDRLFGSHRIGVILTPTTGTS… |
| A0A6A6EMQ5 | 1-167 | MDVRSLPLYNKVQEALVEQSFMHNGGYLGIYCQHAYAHSTPEGSSAIPSVLKGSDMVIYSIFLALGLQVSVHPILDHKCDYEYRYLK… |
| A0A1Y2C1S4 | 759-930 | None |
| A0A0C9XZN2 | 1-232 | None |
| A0A0D7AJV2 | 118-319 | None |
| A0A1L7WPN1 | 365-569 | None |
| A0A2A9NBW9 | 327-490 | None |
| A0A433Q9G2 | 92-268 | None |
| S7QHP7 | 223-426 | None |
| A0A1Y2AEP5 | 158-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.