DPCstruct | MC262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 17.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0489- PF21135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660CB84 | 27-146 | YAALYRPYHYVGLELGISIANAVLRGVPTGAPKGFFGDVVATAKKDLRAGEELDGEGGYSVWGKLISARASVERGALPIALAHHVRL… |
| A0A833G4F9 | 203-332 | DLKMGKGPYFTFHRPYHLTSLEVPLTCARVVLHGKADMVPLAKPVADVCAVAKKDLAPGDRLDAIGEYCYRAWIMTAGEARAARAVP… |
| A0A6J7ALR5 | 180-305 | None |
| A0A1C6K5E6 | 300-457 | None |
| A0A3N5GAN5 | 2-80 | None |
| A0A545B1B1 | 32-180 | None |
| A0A7X3TXT7 | 38-184 | None |
| A0A5S9NJF4 | 1-125 | None |
| A0A7Y2NSN9 | 158-300 | None |
| A0A380ZZ28 | 28-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.