DPCstruct | MC26199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 223 ± 27 aa |
| Standard deviation of domain lengths | 26.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4XGA7 | 2-200 | DQHALLVRLLELFVQLGIEGRRVGEKVSKSTVKMSTSAGNLGVLMPKIATLLKRMSPISQPSTRLRNLFRDFWFYCTVLGFDVEYSG… |
| A0A183K4N4 | 153-369 | KLYKLLHRLLEHYVHVDMELDQDSKSTSILTIAAHGLGQLIPVIAILLKRLSPIQNPNQRLQKLFREFWLSVTVMGFADPNSTIWPV… |
| A9JRB4 | 669-892 | None |
| W2ST04 | 102-303 | None |
| A0A4W6BHU6 | 351-574 | None |
| A0A3P7EVW6 | 612-839 | None |
| Q54ZN9 | 636-947 | None |
| A0A821I4D1 | 1-202 | None |
| A0A2G9V3P2 | 1-218 | None |
| A0A6A4V1X6 | 28-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.