DPCstruct | MC26193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1K1N4 | 2-132 | TRYRDDTDVNGPIREFHGADDDYDPAPACAAYFERLQQAGRDATMTVFPHASHAFDMPYAMPTVVVKGAQTVRACRIVENESGELMN… |
| A0A2V5PQN8 | 18-154 | IPLYASCSMTFIGDTDLSPAPIRQFHGAADDYVPVAPCRPYFERLRAAGRDVQLTEYPDAHHGYDNPLGNKTPTVAKGSQSVRACKL… |
| A0A847VKF9 | 77-241 | None |
| A0A2E7HVN1 | 2-146 | None |
| A0A3C2B191 | 47-189 | None |
| A0A2S6Q9Z9 | 168-314 | None |
| A0A6N8SME2 | 2-118 | None |
| A0A382BBW1 | 211-386 | None |
| A0A2J7VIL1 | 508-645 | None |
| A0A6V8EH81 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.