DPCstruct | MC2619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 144 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6AYZ6 | 54-193 | YVFHWRALDASILAQPAAVALPARFELEITLTRDVISYWQQHATSLRADRCLNEIAFEPRTIAFTLEKGCFGPEWERVPFFSFERQQ… |
| A0A6A6EAP5 | 17-152 | KPLSRERLEQVLTSNNKGGEDSHIAAQFEVEITFLKRRATVLGPLEGYRINEALLKDQAFPPKRFAVSLEKDSYWLPAALRFLSIPA… |
| A0A842YU97 | 10-160 | None |
| A0A5N7D839 | 1-114 | None |
| A0A6A6WKK0 | 43-203 | None |
| A0A6A6BCL4 | 287-442 | None |
| A0A6A6ASY4 | 48-203 | None |
| A0A0C3GQK7 | 37-161 | None |
| D4D3A3 | 3-93 | None |
| A0A6P8BJT7 | 12-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.