DPCstruct | MC26182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF12544- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0EVJ0 | 278-409 | PKPFKEAVRLILNTGATIRSQAPVLRHVNDDPKIWKRLWEDQVSLGIVPYYMFVERDTGAQHYFSLPLLHTHHIYKEAIKSVSGLAR… |
| A0A1J4XDN5 | 231-343 | VLNQTVLLNGVNAHPDILEVLFTKLVEGGIQPYYLHHPDKVRGTSHFRMTLEAGQEIYRELLHRLPDHAVPRYVLDLPGGYGKIPVT… |
| A0A2E6EMI0 | 258-370 | None |
| A0A0F2QZF7 | 233-343 | None |
| A0A7C7SX39 | 2-79 | None |
| A0A559JGM8 | 1-79 | None |
| A0A354H250 | 2-98 | None |
| A0A7X7F9Q7 | 10-89 | None |
| A0A349ULW5 | 113-242 | None |
| Q3Z9Y0 | 258-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.