DPCstruct | MC26180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 10 aa |
| Standard deviation of domain lengths | 9.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09933 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848SJS5 | 2-161 | IDRDLKAIFSALLGLMALFYLLQNLINLDQAYASLDYVMSQADHAAYPGNLLPALGPPWTRAAAWLVFAGEFVTAFLALLGAWKMAR… |
| A0A2E8PDR9 | 49-217 | RLRDQREGMRMEALVLFGQALLTAITGAWIGIGVIENIRYPKVNGDLVTMVMRMDRVREERPEIYADVKGNRIESPAVHAWAYRAII… |
| A0A347PT19 | 2-148 | None |
| A0A7T5CIT7 | 6-184 | None |
| A0A543I674 | 12-179 | None |
| A0A833N5G4 | 3-161 | None |
| A0A354XSI6 | 17-177 | None |
| A0A6L8N4J5 | 2-141 | None |
| A0A0F4QTV0 | 1-167 | None |
| A0A1E1V8G8 | 113-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.