DPCstruct | MC2618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6E4E2 | 1-139 | MVVPRASAVVLGAADAEPIAIHANHIHMVKFGSKSDTGYKTVSSHLQLMAVNAGDVIGLRWVMEGRVNAACSNNPIESFNVQFSVLE… |
| A0A370TIM0 | 195-315 | MEDKIPLDADHSMIVKFDNKNNRGYTSARDKIRQFEQNAPNVVAARFLRAQNRPKPSSIIRFQRDSSFVGREDILVEIGDKFEQAAS… |
| A0A2S4KTM7 | 152-260 | None |
| X0J0X0 | 31-153 | None |
| A0A6A5USQ3 | 19-146 | None |
| L8G7E3 | 448-549 | None |
| A0A094G1G5 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.