DPCstruct | MC26177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1BJ07 | 6-111 | LLDAAPAIPLHAFVAMAAFVLGSIQLAAPKGTLPHRTLGWMWVILMLVVAGSSFWIHQIRLLGPWSPIHLLSIFSLVMLVLGVTAAR… |
| A0A6G9NDZ1 | 36-164 | RSAGDDLTVPILIHLATALAAALLGPFILLRRKGDGRHKALGRTWAGLMLVTAGTSIFIRSPGAGIAGTGFSFIHLFTVWTLAALPV… |
| E0MQ81 | 25-158 | None |
| A0A219B1H5 | 58-175 | None |
| A0A2E2RPK0 | 2-133 | None |
| A0A7Y4XSD8 | 7-148 | None |
| A0A7R7CRA8 | 6-136 | None |
| A0A4P7J9H0 | 50-181 | None |
| A0A2W6X362 | 129-250 | None |
| A0A6L7KZE9 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.