DPCstruct | MC26176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G6EFS2 | 22-134 | LLGGTMVLPEANLVIAGTNCRRPLLLPEALLIAQASMHDVVMLRFDVDRGASFDLFLREGRDVKCCHFAWRSRGGDIWFIPASGKGT… |
| A0A6G9NB28 | 1-135 | MNFAVAAMNGALREHIPVLASSVQSADRPMLVVSFADAHLPVCTGMTLFRPVPAGVEIGMVEPCLLADGGALILVATDRSKAFGIDG… |
| A0A430D9P2 | 4-124 | None |
| A0A0Q5QWV2 | 27-174 | None |
| A0A0Q4FTV8 | 11-154 | None |
| A0A4Q3XZH9 | 8-160 | None |
| A0A1Y5PVI2 | 173-329 | None |
| A0A3D0WJE7 | 20-145 | None |
| A0A848QNI8 | 28-173 | None |
| A0A0Q4IG62 | 15-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.