DPCstruct | MC26174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5XTV9 | 52-202 | AVELDPLLAGADINRGVVVYGSKGGNCVSCHGWDGNGLGKNPRSEGAAALLRESGLDAQGFIEIISCGIPGTPMPYHDASAYKDDRC… |
| A0A3S5IVT8 | 6-141 | FSQSPDYGLKVFKKANCSSCHQWHGDGGGSYGGAAASIRETGLDKEYLQKIVECGRPGTNMPYFSKQAYKDDRCFGLTFSDFEGEEN… |
| A0A2E6QKW0 | 18-166 | None |
| A0A1W1ZX78 | 21-169 | None |
| A0A2F0AHB3 | 50-182 | None |
| A0A327M5D2 | 4-137 | None |
| A0A2G2QHC3 | 141-278 | None |
| A0A8B6MDA0 | 10-164 | None |
| A0A2V8EE08 | 284-429 | None |
| A0A2S6NLE5 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.