DPCstruct | MC26171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2LX35 | 2-74 | TGICNMIQAFCTGQYLQYADVPDCVNLLASKPVNAFPMFFSDTITCRANHLPMTTVDPALHCPHVGPTGGGAC |
| A0A1S8B1L3 | 99-183 | TVAQALCPTIQRQCTGNDRVYQSVDDCIGQLLAKPFGTFDEVWADNVVCRVIHVLLTAIRPDVHCAHVGPTGGGKCVDIDYRLDY |
| A0A817XBQ9 | 113-198 | None |
| A0A1Q5UFV0 | 152-240 | None |
| A0A7S1TAW1 | 169-265 | None |
| A0A2M8BYC1 | 83-175 | None |
| A0A822D8M4 | 71-169 | None |
| A0A2H3D303 | 175-268 | None |
| A0A813YBE1 | 126-229 | None |
| A0A284QNS5 | 634-727 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.