DPCstruct | MC26170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 274 ± 31 aa |
| Standard deviation of domain lengths | 31.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1DSS6 | 1-271 | MGIQKLGGGNTHAHPSPETDLMSLLFRDGGIDIQLSGSPARSDASDMYCPQIRRSPLSNAHAVNHIDVVSCWKGLSLRQASEALMWE… |
| A0A6A5RMP9 | 15-233 | WKGLSRTQATELTMWYQFLDECLHNEVREVLSKEVVQDLMDSNEAIEEVHFFARMLECLRSKPQRIVDIIFIDIIDSMMGMFHDRFP… |
| A0A6A5W1Q1 | 9-266 | None |
| A0A2S6C4N4 | 8-283 | None |
| K2R9A2 | 1-314 | None |
| A0A4Q4R6P6 | 452-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.