DPCstruct | MC2617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 296 ± 60 aa |
| Standard deviation of domain lengths | 59.97 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6E467 | 30-301 | PKNVGDTEVAFNVQLLYTAARNFFACGRLTQKQIAFHEKLGLFTNTYDDVVAGKRRVREPLPGQSIVHNDNTTSCDVNTYRPIPSSQ… |
| A0A165IJP4 | 16-256 | LPAISSLISQHFDRAVTRIERAVDQRLQAFASANVTAFGSGNVTAVSSITPIPAVASQSTTAQPVVRTNAELNPSRKVDINGQSLTF… |
| A0A2H3DCJ9 | 158-406 | None |
| A0A2H3AQV4 | 263-651 | None |
| A0A2H3BGX9 | 11-350 | None |
| A0A401GMB4 | 105-442 | None |
| A0A0C9U2P9 | 16-307 | None |
| A0A4S8MP11 | 64-334 | None |
| V2W3V2 | 10-254 | None |
| E2LUS2 | 113-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.