DPCstruct | MC26168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 219 ± 21 aa |
| Standard deviation of domain lengths | 20.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1H2E5 | 128-338 | LDDHQQVPTHRAERLPSVFRSFVDYNDAALEDYLHGRGVSLRFLVEIDQFLANVPELMEYSPVWADAINTASPLQAYLHFVQGYTRP… |
| A0A0G2G8B6 | 1-211 | MLNQKPLPDRPARLFQCLFHCDDQDLFEYLSLRHISVHFLHEIDQLLRNNPELYHYSPEWAEKFNSFRPLDAYKFFLKGYTKPARYI… |
| A0A6A5RS16 | 111-319 | None |
| A0A074Y8U5 | 205-375 | None |
| A0A178AXT6 | 81-321 | None |
| A0A4S9NGL4 | 86-307 | None |
| A0A6A6X4U0 | 1-243 | None |
| A0A6A5YVN4 | 31-248 | None |
| A0A4S8T3Z2 | 4-245 | None |
| A0A6A6VSB4 | 18-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.