DPCstruct | MC26166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 212 ± 24 aa |
| Standard deviation of domain lengths | 23.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2EVJ6 | 1-222 | MAALQVKLEDRRQQDASMKEVREVLEREWEEVQRPVREKLGAYADEITNRDWMDGRSLSKDNCPQFAADLLIEIRSRFYADLAVEDE… |
| U7PZQ1 | 61-242 | AKKEKTSEEIDAEWDLIQGPVRLKILRYADEAIIGDWDDGDKVTKDNAPAFAADILLHVRKRFYTEVENDAKAARAFGREPTVDPVG… |
| W9YCH8 | 1-208 | None |
| A0A4R8QRQ7 | 2-215 | None |
| G0SER4 | 231-437 | None |
| A0A2C5Z5I2 | 236-394 | None |
| A0A1S8BII4 | 1-221 | None |
| A0A2H3I895 | 11-245 | None |
| A0A1C1CL50 | 17-252 | None |
| A0A0D2KIR2 | 287-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.