DPCstruct | MC26164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 433 |
|---|---|
| Mean domain length (aa) | 150 ± 30 aa |
| Standard deviation of domain lengths | 30.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 99.23 |
| Assigned Pfam label(s) | PF00338- CL0159- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RMQ2 | 50-241 | KRNHGPIPKVDDISRYSVSISGLVNKHIQLSMDDIRMLPKYNVTATLQCAGNKRTAMSKVRKVRGVGWDVSALGNATWGGAKLSDVL… |
| A0A0G2EEH9 | 6-167 | VDEEKWLLVIDGLVRHPFAITLPQLKSLPRTTLTAFHECYGSPLTPPDKALWRIGNVTWTGVKLSSLLDVAAPLARASFIWSEGLDR… |
| A0A6I4SVQ0 | 28-144 | None |
| A0A3D1QX38 | 1-145 | None |
| A0A0D2HRJ4 | 27-178 | None |
| A0A7T5ET21 | 214-361 | None |
| A0A2Z4I362 | 122-252 | None |
| A0A847V6T5 | 89-285 | None |
| A0A1V5BZ86 | 300-433 | None |
| A0A7V9IJD5 | 170-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.