DPCstruct | MC26162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 58 ± 1 aa |
| Standard deviation of domain lengths | 1.32 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 57.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NAY1 | 139-195 | QARQKEFYDRIKKHRVDASRQSFANPVPDYYGEKIASLKGYRQWLRDQKAFRNKSQR |
| A0A364KXF4 | 396-452 | AIKEKEFFNRIKRFRVDPSANSIANPVPDYYGEKIGSVQGYRQWLKDQRAYNRKKSR |
| A0A225B161 | 358-414 | None |
| A0A135UGD9 | 304-360 | None |
| A0A0J0XCK7 | 96-155 | None |
| A0A1V8TBT8 | 203-259 | None |
| A0A507DT51 | 123-182 | None |
| A0A5B0PST1 | 43-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.