DPCstruct | MC26161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 35 aa |
| Standard deviation of domain lengths | 34.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2Y8Q4 | 8-169 | QFSTFKDCIAQRMLHRSDLESDSDDSSALDDFASYLATESWSTLPDNVKNATYETREKVTDVDNIPLESTSTEFIDSLLSYRMVPDT… |
| A0A0G2DZV7 | 9-232 | DEESNFSTFRDCLSEPVIRKLAIKPPKVSKRRAAKGRKSAIKPVYPKDDQDDARQSNDAEELGEFYLALEIFPSLPTDLRTLSYSAT… |
| A0A7S2XRD7 | 1-255 | None |
| A0A4Z0YZ41 | 1-263 | None |
| A0A3N4JLR2 | 1-215 | None |
| A0A383W3Z1 | 81-308 | None |
| A0A6G1FT74 | 2-192 | None |
| A0A3M7M6X2 | 293-534 | None |
| C9SXX7 | 8-206 | None |
| A0A168CS49 | 6-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.