DPCstruct | MC2616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8MWD6 | 77-197 | MAGELWLLLIKLSGKIKRAEEMIGRVRSAENRETIHDFLGGGERLTDKLRSLLKACEAPMLRAAAKKKSPGLGKHSGVEFVDTLFGR… |
| A0A6A6E3A3 | 1-107 | MAGDLWLLLIQYASKFRRGEEVLSKVRGRENRYVMEDFLDSADRLWARLNKLIKKCEAYMWKQAKRRGRDKDGNLKMGKNAGCDFVD… |
| A0A4U0WYG0 | 232-359 | None |
| A0A1L7X394 | 1090-1212 | None |
| A0A6A5K2B4 | 472-595 | None |
| A0A094HSC5 | 534-653 | None |
| A0A6A6PAQ0 | 280-400 | None |
| H0EGD4 | 1-117 | None |
| A0A0J8UXB6 | 167-288 | None |
| A0A6G1KXK3 | 91-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.