DPCstruct | MC26150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5EI25 | 9-124 | YEMFCYQCEQTANGKGCTKLGVCGKTPEVANLQDLLVFQLKGISCYAKALTDSGQHVDKAIVSFIENCLFTTLTNVNFDAEVHVALL… |
| A0A4Y1ZAJ8 | 3-97 | KRMFCYQCQETARGRGCTLVGVCGKKPEVAAAQDLLVYVTKGLSAVTMRLRDEGKKISADINHLVTENLFTTITNANFDEQAIRSLV… |
| A0A090SMM9 | 1-88 | None |
| A0A6N6XGB4 | 1-80 | None |
| A0A7H4P738 | 13-148 | None |
| A0A0V0QJA2 | 114-271 | None |
| A0A1V1V523 | 3-100 | None |
| A0A848A5Q6 | 1-128 | None |
| A0A379WWF8 | 1-136 | None |
| A0A7V4HHA4 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.