DPCstruct | MC2615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8QG32 | 2-100 | DSSEANRMATRAQQDLNTYQAKQGLGRKSDSTLESGVDELVNRRFDQPTDVRYGREAVPTASDRKPIPEDEGGIRDDRGRLAPAQGF… |
| A0A6A6E2M3 | 9-123 | DPLTIAKEAEQDFNSHPAKSGHDLKPASRYGHGASDSTLESGVDESVRHKFPGGDVIYGSGASGASDNREIPLSEGGDIDPRSGKPY… |
| Q4WK62 | 77-180 | None |
| A0A1V6TUW2 | 33-131 | None |
| A0A0J9WKD8 | 42-155 | None |
| A0A175WF96 | 12-125 | None |
| A0A179UJV6 | 29-131 | None |
| A0A0A2VCE9 | 1-98 | None |
| V5GAB0 | 1-107 | None |
| A0A1Z5T1T0 | 281-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.