DPCstruct | MC26149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9RAN9 | 122-219 | SLIYSEVEIRTDFGYTCFLMAGFCDRDRLEADENFQAFMEGTTDSEVNASVYSYSVGTGESVSPNEDELAIIKQYADELGEEYDVDS… |
| A0A1G5CDL3 | 1-104 | MAILFSKVTLTADNGNTAQLLCGGIPTSNYDLEDWLIYQKFICDNMSCREIKAKVESFLYGEGEIFNANEYEVAAYTGRGEKFLNHP… |
| A0A1C0BJL7 | 166-282 | None |
| A0A1M5V289 | 132-237 | None |
| A0A351TNU3 | 101-194 | None |
| A0A173YC83 | 1-117 | None |
| A0A143X005 | 2-95 | None |
| A0A1E3A0Q9 | 158-265 | None |
| A0A417KXB7 | 238-334 | None |
| R7PKK7 | 151-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.