DPCstruct | MC26147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 116 ± 24 aa |
| Standard deviation of domain lengths | 24.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9RN68 | 195-326 | AQKTVEPVSPMLAPYKVVIDALADKYEPSNFTHRRHLTSLMERIKDDKLAQAFHNKPEILCATCHHRSPLSLTPPKCGSCHTKEIDK… |
| A0A7C7VHG6 | 13-118 | FLAVATVAFCNPAAPAGDISMKGPKKGAVNFSHKVHIEKAKISDCKTCHHTFKGEGDPKKCSECHKLKKDGKALDIKTATHKKCKGC… |
| A0A3M1D431 | 10-109 | None |
| A0A847DBR2 | 262-403 | None |
| A0A661NPR5 | 359-511 | None |
| A0A2N6F013 | 94-160 | None |
| A0A0S8CUL6 | 10-148 | None |
| A0A496RER4 | 11-107 | None |
| A0A1F9P535 | 9-126 | None |
| A0A6V8LT21 | 154-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.