DPCstruct | MC26146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 200 ± 27 aa |
| Standard deviation of domain lengths | 26.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377A5G2 | 59-231 | ENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCA… |
| A0A7C7RGI4 | 6-213 | VGRGVDLALGYGDKVYEIEPELNKRIHDLYDDAKISLWAEFTPEFVKTIPNALEITTKSQDREEYVADPASGEELSEATVATLEKLR… |
| G2ZNG5 | 22-243 | None |
| A0A6I3KZ05 | 13-258 | None |
| A0A7W1L2I2 | 110-361 | None |
| J3EQ02 | 38-262 | None |
| A0A536SX48 | 296-516 | None |
| A0A3M2UGR1 | 100-318 | None |
| A0A149UHN8 | 10-207 | None |
| H6SIR0 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.