DPCstruct | MC26143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02663 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662JQF7 | 77-240 | GMPYELLQAAELHNHICPGLTSGILIMRYLDEVLPIESSSQYYVILAVPPWCKDDAFQAVYDSTVGKRRMRVMMLSKEQSEQLPPVA… |
| A0A7C1JEE3 | 7-159 | LLELGLKFHGHKCPAMPMGLKAGLYAMEKLGVERARDGQLHAILELDENHCATCFADGVQVATGCTFGKGNISKTGDGKWGLTLIDK… |
| A0A1V5C5S0 | 18-174 | None |
| A0A537TEB7 | 19-162 | None |
| A0A849QPT2 | 375-540 | None |
| A0A218ZQX6 | 23-182 | None |
| A0A496SGK9 | 67-196 | None |
| A0A521UA65 | 217-342 | None |
| A0A3M1IC89 | 128-307 | None |
| A0A3A4U100 | 6-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.