DPCstruct | MC26142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 1 aa |
| Standard deviation of domain lengths | 1.34 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661PFP3 | 1-69 | MLIVMKKGAGEEQLRQVKQYLVDHDFDFHQSTGANRTIIGVIGDTETVNCDELEAQDGVHVIFKIPEEK |
| A0A7C1J5R2 | 1-69 | MLVIMEATATQEDIEKVKDYLISKNFDIHQSTGMKHVIIGIIGDVVGFDSTELENMSGVQQVVKITEYK |
| A0A6M0EML9 | 1-69 | None |
| A0A7V2MHT9 | 1-65 | None |
| W9ECI0 | 1-66 | None |
| A0A7V6MHK7 | 1-67 | None |
| A0A7V4J360 | 1-67 | None |
| E6QDZ1 | 1-67 | None |
| A0A1W9NW86 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.