DPCstruct | MC26141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 408 ± 79 aa |
| Standard deviation of domain lengths | 78.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.33 |
| Pfam Score | 49.27 |
| Assigned Pfam label(s) | CL0023- PF04403- CL0375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812UAF2 | 52-432 | KHFNAKNREPFWVLLLVLVSYGYLIPGLVEVLFSFNLVFDTGTGGFFGIGPDSSFNHAPPTTETMLGLVRLLWETGSWLGAVLVVFY… |
| A0A7C1AY36 | 25-372 | TVNQNIFVLIRSRLNQPGTLSLGSAGRTKLIPWLLLVSFVFNVIALIVPFLKIDTFLSSEKIYSLPHSVALMWHARLYAIALLILGF… |
| A0A6F9CGJ5 | 166-588 | None |
| A0A7S2UC07 | 603-1097 | None |
| A0A7R9WZN7 | 48-391 | None |
| A0A2D8AT86 | 22-439 | None |
| A0A4Q7KGL8 | 6-392 | None |
| A0A1Q9C8N6 | 759-1223 | None |
| A0A3S7X098 | 420-821 | None |
| A0A3S4JAN9 | 51-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.