DPCstruct | MC26139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF21175- CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6SHC0 | 51-142 | FVLNGLISTVENILPVDLNINQLQHRLDEGVKEMILALNPTVEGETTALYLAKKFSNQCEITRLAQGLPMGGQLEYVDDLTLLRSML… |
| A0A7C0ZJP9 | 11-94 | QGVGPEDLRLDRLKGLVVRQQVQEVIISTNLTVEGNATAVYIATLLKPLNIHISRPACGLPVGADFEYMDPVTIEKSINGRCKL |
| A0A554KZ94 | 35-132 | None |
| A0A377ZDR4 | 217-310 | None |
| Q7VBJ4 | 77-168 | None |
| A0A5B8XIT8 | 102-199 | None |
| A0A381GRD7 | 1-77 | None |
| A0A327KMR8 | 247-339 | None |
| A0A7V2ZGS6 | 18-117 | None |
| A0A7Y2E565 | 10-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.