DPCstruct | MC26136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9FHX8 | 1-79 | MEEVAREEVEIDKDLRRKIKKTVKKILESSNLYKITEIKAREEASLKLDLDLSQDPYKVIVKEEVENFLEEAVKLIGNK |
| A0A5J5P9Z9 | 1-77 | MEQETRQKIEETVKDMLSKADMEEMTEFKVRVTASEWLGIDLSDFSHRKFIRELVESFLLSTVEENVDGKQPNSKPV |
| B9RCV6 | 2-75 | None |
| A0A2N9H677 | 1-66 | None |
| A0A803M4S7 | 1-80 | None |
| A0A834XF45 | 1-78 | None |
| A0A7J7CJW4 | 3-82 | None |
| A0A396HA31 | 1-68 | None |
| A0A200QCJ7 | 5-79 | None |
| A0A804K346 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.