DPCstruct | MC26133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 4 aa |
| Standard deviation of domain lengths | 3.61 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143BM27 | 11-100 | NTQVRITSEGRSGVIHFENPQSTFSMWWEFAGAGALAIINIPSVAQWESTTKLPLSQREDVLRIIGEHVVRTQTSGRGRYDVDEQFI… |
| A0A2P8FR93 | 287-376 | FPKLEYTQDGRGGSIYYTEGAIKIQFGWEFGGGNAVVILFIPETKYWEAQTGTPLSRRDEILKFLCEQVIRDQAPGCTYKIYENSIS… |
| A0A7Y5R8Q0 | 165-254 | None |
| A0A1S2VEK9 | 55-156 | None |
| A0A7V8BJH5 | 1-93 | None |
| A0A7V4YY96 | 51-139 | None |
| F4L6D3 | 134-223 | None |
| A0A5S4EH14 | 5-97 | None |
| A0A7T9FI69 | 66-157 | None |
| W0RT64 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.