DPCstruct | MC26128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 54.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7M9R6 | 421-488 | HGGDEEDDDGINQLFLHVAVSKPNQADSLHFLCGLYPDALGIHSVSMRPKLEDLEMSDDPTQYTGPSF |
| A0A2K3LZ74 | 1-87 | MPDLVTGEEHDRDDENDDKDDESERANQSSIPLVVNVSKKGGPSLEFSCVAYPDEIVIDSLSVKNPDVSDDQIPYEGPSFQYVLLAF |
| A0A1D1XZ02 | 72-140 | None |
| A0A6P5Y8D6 | 158-232 | None |
| A0A830CPK1 | 12-89 | None |
| A0A067KT84 | 1-74 | None |
| A0A7J8U134 | 36-112 | None |
| A0A453FLW8 | 54-152 | None |
| A0A7C8ZAX3 | 63-140 | None |
| A0A067E0W9 | 73-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.